Klk14, Recombinant, Mouse, aa24-250, His-Tag (Kallikrein-14)

Klk14, Recombinant, Mouse, aa24-250, His-Tag (Kallikrein-14)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
373931.20 20 µg - -

3 - 19 Werktage*

575,00 €
373931.100 100 µg - -

3 - 19 Werktage*

855,00 €
 
Serine-type endopeptidase with a dual trypsin-like and chymotrypsin-like substrate specificity.... mehr
Produktinformationen "Klk14, Recombinant, Mouse, aa24-250, His-Tag (Kallikrein-14)"
Serine-type endopeptidase with a dual trypsin-like and chymotrypsin-like substrate specificity. May activate/inactivate the proteinase-activated receptors F2R, F2RL1 and F2RL3 and other kallikreins including KLK1, KLK3, KLK5 and KLK11. May function in seminal clot liquefaction through direct cleavage of the semenogelin SEMG1 and SEMG2 and activation of KLK3. May function through desmoglein DSG1 cleavage in epidermal desquamation a process by which the most superficial corneocytes are shed from the skin surface. May be involved in several aspects of tumor progression including growth, invasion and angiogenesis. Source: Recombinant protein corresponding to aa24-250 from mouse Klk14, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~28.5kD, AA Sequence: IIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAHCARPILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLGRAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHRAYPGIITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWIQRTMQSN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Gk14, mGK14, Klk14, EC=3.4.21.-, Kallikrein-14, Glandular kallikrein KLK14, Kallikrein related-peptidase 14
Hersteller: United States Biological
Hersteller-Nr: 373931

Eigenschaften

Konjugat: No
MW: 28,5
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Klk14, Recombinant, Mouse, aa24-250, His-Tag (Kallikrein-14)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen