Interleukin-4 Receptor Subunit Alpha, Recombinant, Porcine, aa33-240, His-tag (IL4R)

Interleukin-4 Receptor Subunit Alpha, Recombinant, Porcine, aa33-240, His-tag (IL4R)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405964.20 20 µg - -

3 - 19 Werktage*

455,00 €
405964.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The... mehr
Produktinformationen "Interleukin-4 Receptor Subunit Alpha, Recombinant, Porcine, aa33-240, His-tag (IL4R)"
Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2. Source: Recombinant protein corresponding to aa33-240 from Porcine Interleukin-4 Receptor Subunit Alpha, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~28.2kD, AA Sequence: VRVLEWPICLSDYVSTSTCEWRMAGPVNCSAEFRLSYQLKFFNTENHTTCVPENRAGSVCVCHMLMESIVIVDTYQLDLWAGEQLLWNSSFKPSQNVKPLAPRNLMVHANISHTWLLTWSNPYPSESYLYSELTYLVNISNENDPTDFRIYNVTYLGPTLRFPANTLKSGAAYSARVKAWAQRYNSTWSEWSPSVKWLNYYEEPLEQR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: IL4R, CD124, IL-4RA, IL-4R-alpha, IL-4R subunit alpha, IL-4 receptor subunit alpha, Interleukin-4 receptor subunit alpha
Hersteller: United States Biological
Hersteller-Nr: 405964

Eigenschaften

Konjugat: No
MW: 28,2
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Interleukin-4 Receptor Subunit Alpha, Recombinant, Porcine, aa33-240, His-tag (IL4R)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen