Insulin-1, Recombinant, Mouse, aa25-108, His-tag, Myc-tag (Ins1)

Insulin-1, Recombinant, Mouse, aa25-108, His-tag, Myc-tag (Ins1)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405956.20 20 µg - -

3 - 19 Werktage*

511,00 €
405956.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides,... mehr
Produktinformationen "Insulin-1, Recombinant, Mouse, aa25-108, His-tag, Myc-tag (Ins1)"
Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, aa's and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. Source: Recombinant protein corresponding to aa25-108 from mouse Insulin-1, fused to His-tag at N-terminal and Myc-tag at C-terminal, expressed in E. coli. Molecular Weight: ~14.5kD, AA Sequence: FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Ins1, Ins-1
Hersteller: United States Biological
Hersteller-Nr: 405956

Eigenschaften

Konjugat: No
MW: 14,5
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Insulin-1, Recombinant, Mouse, aa25-108, His-tag, Myc-tag (Ins1)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen