Insulin-1, Recombinant, Mouse, aa25-108, His-tag, Myc-tag (Ins1)

Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, aa's and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. Source: Recombinant protein corresponding to aa25-108 from mouse Insulin-1, fused to His-tag at N-terminal and Myc-tag at C-terminal, expressed in E. coli. Molecular Weight: ~14.5kD, AA Sequence: FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.