Homeobox Protein Nkx-3.2, Recombinant, Human, aa1-333, His-Tag (Nkx3-2)

Homeobox Protein Nkx-3.2, Recombinant, Human, aa1-333, His-Tag (Nkx3-2)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
370648.50 50 µg - -

3 - 19 Werktage*

431,00 €
370648.100 100 µg - -

3 - 19 Werktage*

629,00 €
 
Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a... mehr
Produktinformationen "Homeobox Protein Nkx-3.2, Recombinant, Human, aa1-333, His-Tag (Nkx3-2)"
Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development, required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear, required for tympanic ring and gonium development and in the regulation of the width of the malleus. Source: Recombinant protein corresponding to aa1-333 from human Nkx3-2, fused to His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~56.63kD, AA Sequence: MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Bapx1, Nkx3-2, Homeobox protein Nkx-3.2, Homeobox protein NK-3 homolog B, Bagpipe homeobox protein homolog 1
Hersteller: United States Biological
Hersteller-Nr: 370648

Eigenschaften

Konjugat: No
MW: 56,63
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Homeobox Protein Nkx-3.2, Recombinant, Human, aa1-333, His-Tag (Nkx3-2)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen