Heat-labile Enterotoxin A Chain, Recombinant, E. coli, aa19-258, His-SUMO-tag, Myc-tag (eltA)

Heat-labile Enterotoxin A Chain, Recombinant, E. coli, aa19-258, His-SUMO-tag, Myc-tag (eltA)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405938.20 20 µg - -

3 - 19 Werktage*

455,00 €
405938.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
The biological activity of the toxin is produced by the A chain, which activates intracellular... mehr
Produktinformationen "Heat-labile Enterotoxin A Chain, Recombinant, E. coli, aa19-258, His-SUMO-tag, Myc-tag (eltA)"
The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase. Source: Recombinant protein corresponding to aa19-258 from Escherichia Coli Heat-labile Enterotoxin A Chain, fused to His-SUMO-tag at N-terminal and fused to Myc-tag at C-terminal, expressed in E. coli. Molecular Weight: ~45.3kD, AA Sequence: NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: ltpA, eltA, LTP-A, LT-A, porcine, Heat-labile enterotoxin A chain
Hersteller: United States Biological
Hersteller-Nr: 405938

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: E.coli
MW: 45.3 kD
Reinheit: ~85% (SDS-PAGE)

Datenbank Information

UniProt ID : P06717 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Heat-labile Enterotoxin A Chain, Recombinant, E. coli, aa19-258, His-SUMO-tag, Myc-tag (eltA)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen