GPC6, Recombinant, Human, aa24-529, His-Tag (Glypican-6)

GPC6, Recombinant, Human, aa24-529, His-Tag (Glypican-6)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
373510.20 20 µg - -

3 - 19 Werktage*

531,00 €
373510.100 100 µg - -

3 - 19 Werktage*

773,00 €
 
Cell surface proteoglycan that bears heparan sulfate. Putative cell surface coreceptor for growth... mehr
Produktinformationen "GPC6, Recombinant, Human, aa24-529, His-Tag (Glypican-6)"
Cell surface proteoglycan that bears heparan sulfate. Putative cell surface coreceptor for growth factors, Extracellular domain matrix proteins, proteases and anti-proteases. Enhances migration and invasion of cancer cells through WNT5A signaling. Source: Recombinant protein corresponding to aa24-529 from human Glypican-6, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~59.5kD, AA Sequence: DVKARSCGEVRQAYGAKGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVSKVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLANQADLDTEWNLFIDAMLLVAERLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGCGQPKPAPALRSARSAPENFNTRFRPYNPEERPTTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTICKDESVTAGTSNEEECWNGHSKARYLPEIMNDGLTNQINNPEVDVDITRPDTFIRQQIMALRVMTNKLKNAYNGNDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRREVDS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: GPC6
Hersteller: United States Biological
Hersteller-Nr: 373510

Eigenschaften

Konjugat: No
MW: 59,5
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "GPC6, Recombinant, Human, aa24-529, His-Tag (Glypican-6)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen