Glucan Endo-1,3-Alpha-Glucosidase Agn1, Recombinant, Schizosaccharomyces Pombe, aa21-424, His-Tag, M

Glucan Endo-1,3-Alpha-Glucosidase Agn1, Recombinant, Schizosaccharomyces Pombe, aa21-424, His-Tag, M
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517926.20 20 µg - -

3 - 19 Werktage*

455,00 €
517926.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
Has a role in cell separation where it is required for the degradation of the cell wall material... mehr
Produktinformationen "Glucan Endo-1,3-Alpha-Glucosidase Agn1, Recombinant, Schizosaccharomyces Pombe, aa21-424, His-Tag, M"
Has a role in cell separation where it is required for the degradation of the cell wall material surrounding the septum (the septum edging) which must be hydrolyzed before full separation of the daughter cells can occur. Hydrolyzes 1,3-alpha-glucan predominantly into pentasaccharides. Source: Recombinant protein corresponding to aa21-424 of Schizosaccharomyces Pombe Glucan Endo-1,3-Alpha-Glucosidase Agn1, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~51.8kD, AA Sequence: DKMVVAHFIVGNTYPYTVSNWEEDIQDAIAVGIDGFALNMGSDAWQVERIEDAYDAAASVSSDFKLFISFDMSIISADADFIEGVVRRFADKPNQLYYDGKVFVSTFAGETDTFGYSDVSTGWDSAVKEPLASAGYPIYFVPSWTSLGQGALEESVADGFLSWNAWPTTDADMNDNDDIGYQNLANSLGKLYVAPVSPWFYTHLSYKNWAYKSDWLIIDRWNEMLSVQPDMIEVLTWNDYGESHYIGNIQGALPAGSEGYVDGFDHTAWRYLMSPYISAYKLGLSEPYINFESLFYWYRPTPKSATATADSLSYPSGGDYMEDEIFVLVYLLQSAEVTVTCGSTTQTFSGVPGVNQFTIPMETNASPSFTVARQGGTLASGTGPEIVDSLSIYNFNAYTGVLYF, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: agn1, EC=3.2.1.59, SPAC14C4.09, Endo-1,3-alpha-glucanase agn1, Glucan endo-1,3-alpha-glucosidase agn1
Hersteller: United States Biological
Hersteller-Nr: 517926

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Yeast
MW: 51.8 kD
Reinheit: ?85% (SDS-PAGE)

Datenbank Information

UniProt ID : O13716 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Glucan Endo-1,3-Alpha-Glucosidase Agn1, Recombinant, Schizosaccharomyces Pombe, aa21-424, His-Tag, M"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen