Galectin-4, Recombinant, Rat, aa1-324 (Lgals4)

Galectin-4, Recombinant, Rat, aa1-324 (Lgals4)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517917.20 20 µg - -

3 - 19 Werktage*

661,00 €
 
Galectin that binds lactose and a related range of sugars.||Source:|Recombinant full length... mehr
Produktinformationen "Galectin-4, Recombinant, Rat, aa1-324 (Lgals4)"
Galectin that binds lactose and a related range of sugars. Source: Recombinant full length protein corresponding to aa1-324 of rat Galectin-4, expressed in E. coli. Molecular Weight: ~36.3kD, AA Sequence: MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMNPRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSHRFQAFQRVDMLEIKGDITLSYVQI, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Gal-4, L36LBP, Lgals4, Galectin-4, Lactose-binding lectin 4, L-36 lactose-binding protein
Hersteller: United States Biological
Hersteller-Nr: 517917

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Rat
MW: 36.3 kD
Reinheit: ?85% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Galectin-4, Recombinant, Rat, aa1-324 (Lgals4)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen