F420-Dependent NADP Reductase, Recombinant, Methanothermobacter Marburgensis, aa1-224, His-Tag, Myc-

F420-Dependent NADP Reductase, Recombinant, Methanothermobacter Marburgensis, aa1-224, His-Tag, Myc-
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517899.20 20 µg - -

3 - 19 Werktage*

591,00 €
 
Catalyzes the reduction of NADP+ with F420H2 via hydride transfer, and the reverse reaction, i.e.... mehr
Produktinformationen "F420-Dependent NADP Reductase, Recombinant, Methanothermobacter Marburgensis, aa1-224, His-Tag, Myc-"
Catalyzes the reduction of NADP+ with F420H2 via hydride transfer, and the reverse reaction, i.e. the reduction of F420 with NADPH. Probably functions in the regeneration of NADPH required in biosynthetic reactions. Source: Recombinant full length protein corresponding to aa1-224 of Methanothermobacter Marburgensis F420-Dependent NADP Reductase, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~27.4kD, AA Sequence: MKIAVLGGTGDQGLGLALRLALAGEEVIIGSRDAEKAVSAAQKVLEIAERDDLKVKGATNAEAAEEAEVAILTVPLQAQMATLGSVKEAIKGKVLIDATVPIDSCLGGSAVRYIDLWDGSAAERAARFLEDQGTRVAAAFNNISASALLDITGPVDCDCLIASDHRDALDLASELAEKIDGVRAIDCGGLENARVIEKITPLLINLNIKNRIRNAGIRITNLPE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: MTBMA_c06980, F420H2:NADP oxidoreductase, F420-dependent NADP reductase
Hersteller: United States Biological
Hersteller-Nr: 517899

Eigenschaften

Konjugat: No
Wirt: Insect cells
Spezies-Reaktivität: Methanothermobacter marburgensis
MW: 27.4 kD
Reinheit: >=85% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "F420-Dependent NADP Reductase, Recombinant, Methanothermobacter Marburgensis, aa1-224, His-Tag, Myc-"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen