Diacylglycerol acyltransferase/mycolyltransferase Ag85B, Recombinant, Mycobacterium Tuberculosis, aa

Diacylglycerol acyltransferase/mycolyltransferase Ag85B, Recombinant, Mycobacterium Tuberculosis, aa
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405906.20 20 µg - -

3 - 19 Werktage*

511,00 €
405906.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria... mehr
Produktinformationen "Diacylglycerol acyltransferase/mycolyltransferase Ag85B, Recombinant, Mycobacterium Tuberculosis, aa"
The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM. Source: Recombinant protein corresponding to aa41-325 from mycobacterium tuberculosis Diacylglycerol Acyltransferase/mycolyltransferase Ag85B, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.2kD, AA Sequence: FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: 85B, fbpB, DGAT, Ag85B, Fbps B, MT1934, EC=2.3.1.20, EC=2.3.1.122, Antigen 85 complex B, Extracellular alpha-antigen, 30 kDa extracellular protein, Fibronectin-binding protein B, Acyl-CoA:diacylglycerol acyltransferase
Hersteller: United States Biological
Hersteller-Nr: 405906

Eigenschaften

Konjugat: No
MW: 36,2
Format: Purified

Datenbank Information

KEGG ID : K18851 | Passende Produkte
UniProt ID : P9WQP0 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Diacylglycerol acyltransferase/mycolyltransferase Ag85B, Recombinant, Mycobacterium Tuberculosis, aa"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen