Decorin, Recombinant, Mouse, aa35-354, His-Tag (Dcn)

Decorin, Recombinant, Mouse, aa35-354, His-Tag (Dcn)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517867.20 20 µg - -

3 - 19 Werktage*

455,00 €
517867.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
May affect the rate of fibrils formation.||Source:|Partial recombinant protein corresponding to... mehr
Produktinformationen "Decorin, Recombinant, Mouse, aa35-354, His-Tag (Dcn)"
May affect the rate of fibrils formation. Source: Partial recombinant protein corresponding to aa35-354 of mouse Decorin, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.9kD, AA Sequence: GIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Dcn, PG40, PG-S2, Decorin, Bone proteoglycan II
Hersteller: United States Biological
Hersteller-Nr: 517867

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Mouse
MW: 39.9 kD
Reinheit: ?85% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Decorin, Recombinant, Mouse, aa35-354, His-Tag (Dcn)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen