DAP, Recombinant, Human, aa2-102, GST-Tag (Death-Associated Protein 1)

Negative regulator of autophagy. Involved in mediating interferon-gamma-induced cell death. Source: Recombinant protein corresponding to aa2-102 from human DAP1, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~38.0kD, AA Sequence: SSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.