Cytosolic Endo-beta-N-acetylglucosaminidase, Recombinant, Human, aa1-377, His-SUMO-tag (ENGASE)

Cytosolic Endo-beta-N-acetylglucosaminidase, Recombinant, Human, aa1-377, His-SUMO-tag (ENGASE)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405899.20 20 µg - -

3 - 19 Werktage*

455,00 €
405899.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
Endoglycosidase that releases N-glycans from glycoproteins by cleaving the beta-1,4-glycosidic... mehr
Produktinformationen "Cytosolic Endo-beta-N-acetylglucosaminidase, Recombinant, Human, aa1-377, His-SUMO-tag (ENGASE)"
Endoglycosidase that releases N-glycans from glycoproteins by cleaving the beta-1,4-glycosidic bond in the N,N'-diacetylchitobiose core. Involved in the processing of free oligosaccharides in the cytosol. Source: Recombinant protein corresponding to aa1-377 from Human Cytosolic Endo-beta-N-acetylglucosaminidase, fused to His-SUMO-tag at N-terminal, expressed in E. coli. Molecular Weight: ~59.1kD, AA Sequence: MEAAAVTVTRSATRRRRRQLQGLAAPEAGTQEEQEDQEPRPRRRRPGRSIKDEEEETVFREVVSFSPDPLPVRYYDKDTTKPISFYLSSLEELLAWKPRLEDGFNVALEPLACRQPPLSSQRPRTLLCHDMMGGYLDDRFIQGSVVQTPYAFYHWQCIDVFVYFSHHTVTIPPVGWTNTAHRHGVCVLGTFITEWNEGGRLCEAFLAGDERSYQAVADRLVQITQFFRFDGWLINIENSLSLAAVGNMPPFLRYLTTQLHRQVPGGLVLWYDSVVQSGQLKWQDELNQHNRVFFDSCDGFFTNYNWREEHLERMLGQAGERRADVYVGVDVFARGNVVGGRFDTDKSLELIRKHGFSVALFAPSCSVFPGVGNLLCC, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: ENGase, ENGASE, EC=3.2.1.96, Cytosolic endo-beta-N-acetylglucosaminidase
Hersteller: United States Biological
Hersteller-Nr: 405899

Eigenschaften

Konjugat: No
MW: 59,1
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Cytosolic Endo-beta-N-acetylglucosaminidase, Recombinant, Human, aa1-377, His-SUMO-tag (ENGASE)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen