Cytomegalovirus Uncharacterized Protein UL128, Recombinant, Human, aa1-171, His-Tag (UL128)

Cytomegalovirus Uncharacterized Protein UL128, Recombinant, Human, aa1-171, His-Tag (UL128)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517862.20 20 µg - -

3 - 19 Werktage*

511,00 €
517862.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Source:|Recombinant full length protein corresponding to aa1-171 of human Cytomegalovirus... mehr
Produktinformationen "Cytomegalovirus Uncharacterized Protein UL128, Recombinant, Human, aa1-171, His-Tag (UL128)"
Source:, Recombinant full length protein corresponding to aa1-171 of human Cytomegalovirus Uncharacterized Protein UL128, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~23.7kD, AA Sequence: MSPKDLTPFLTTLWLLLGHSRVPRVRAEECCEFINVNHPPERCYDFKMCNRFTVALRCPDGEVCYSPEKTAEIRGIVTTMTHSLTRQVVHNKLTSCNYNPLYLEADGRIRCGKVNDKAQYLLGAAGSVPYRWINLEYDKITRIVGLDQYLESVKKHKRLDVCRAKMGYMLQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: UL128, Uncharacterized protein UL128
Hersteller: United States Biological
Hersteller-Nr: 517862

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Human
MW: 23.7 kD
Reinheit: ?85% (SDS-PAGE)

Datenbank Information

UniProt ID : P16837 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Cytomegalovirus Uncharacterized Protein UL128, Recombinant, Human, aa1-171, His-Tag (UL128)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen