CRYGS, Recombinant, Human, aa1-178, GST-Tag (Beta-crystallin S)

Crystallins are the dominant structural components of the vertebrate eye lens. Source: Recombinant protein corresponding to aa1-178 from human CRYGS, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.9kD, AA Sequence: SKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.