COP9 Signalosome Complex Subunit 2, Recombinant, Human, aa1-443 (COPS2)

COP9 Signalosome Complex Subunit 2, Recombinant, Human, aa1-443 (COPS2)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405898.20 20 µg - -

3 - 19 Werktage*

497,00 €
405898.100 100 µg - -

3 - 19 Werktage*

827,00 €
 
Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular... mehr
Produktinformationen "COP9 Signalosome Complex Subunit 2, Recombinant, Human, aa1-443 (COPS2)"
Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Involved in early stage of neuronal differentiation via its interaction with NIF3L1. Source: Recombinant protein corresponding to aa1-443 from human COP9 signalosome complex subunit 2, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.6kD, AA Sequence: MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: SGN2, CSN2, COPS2, TRIP-15, Alien homolog, Signalosome subunit 2, TR-interacting protein 15, COP9 signalosome complex subunit 2, JAB1-containing signalosome subunit 2, Thyroid receptor-interacting protein 15
Hersteller: United States Biological
Hersteller-Nr: 405898

Eigenschaften

Konjugat: No
MW: 53,6
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "COP9 Signalosome Complex Subunit 2, Recombinant, Human, aa1-443 (COPS2)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen