Cold-Inducible RNA-Binding Protein, Recombinant, Mouse, aa1-172, His-Tag (CIRBP)

Cold-Inducible RNA-Binding Protein, Recombinant, Mouse, aa1-172, His-Tag (CIRBP)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517846.20 20 µg - -

3 - 19 Werktage*

511,00 €
517846.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response... mehr
Produktinformationen "Cold-Inducible RNA-Binding Protein, Recombinant, Mouse, aa1-172, His-Tag (CIRBP)"
Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Promotes assembly of stress granules (SGs), when overexpressed. Seems to play an essential role in cold-induced suppression of cell proliferation. Acts as a translational repressor. Acts as a translational activator. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Source: Recombinant full length protein corresponding to aa1-172 of mouse Cold-Inducible RNA-Binding Protein, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~22.6kD, AA Sequence: MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Cirp, Cirbp, A18 hnRNP, Cold-inducible RNA-binding protein, Glycine-rich RNA-binding protein CIRP
Hersteller: United States Biological
Hersteller-Nr: 517846

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Mouse
MW: 22.6 kD
Reinheit: ?90% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Cold-Inducible RNA-Binding Protein, Recombinant, Mouse, aa1-172, His-Tag (CIRBP)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen