CNKSR2, Recombinant, Human, aa650-800, His-Tag (Connector Enhancer of Kinase Suppressor of Ras 2)

May function as an adapter protein or regulator of Ras signaling pathways. Source: Recombinant protein corresponding to aa650-800 from human CNKSR2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~19.1kD, AA Sequence: AAEHLDDMNRWLNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTSSGLHYLQTLPLEDSVFSDSAAI, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.