Clumping Factor A, Recombinant, Staphylococcus Aureus, aa228-558 (ClfA)

Clumping Factor A, Recombinant, Staphylococcus Aureus, aa228-558 (ClfA)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405894.20 20 µg - -

3 - 19 Werktage*

626,00 €
405894.100 100 µg - -

3 - 19 Werktage*

932,00 €
 
Cell surface-associated protein implicated in virulence. Promotes bacterial attachment... mehr
Produktinformationen "Clumping Factor A, Recombinant, Staphylococcus Aureus, aa228-558 (ClfA)"
Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps. Source: Recombinant protein corresponding to aa228-558 from Staphylococcus aureus Clumping factor A, expressed in E. coli. Molecular Weight: ~36.1kD, AA Sequence: GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: clfA, SAS0752, Clumping factor A, Fibrinogen receptor A, Fibrinogen-binding protein A
Hersteller: United States Biological
Hersteller-Nr: 405894

Eigenschaften

Konjugat: No
MW: 36,1
Format: Purified

Datenbank Information

KEGG ID : K14201 | Passende Produkte
UniProt ID : Q6GB45 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Clumping Factor A, Recombinant, Staphylococcus Aureus, aa228-558 (ClfA)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen