CDY1, Recombinant, Human, aa2-90, His-Tag (Chromodomain Protein Y-Linked 1, CDY, Testis-Specific Chr

CDY1, Recombinant, Human, aa2-90, His-Tag (Chromodomain Protein Y-Linked 1, CDY, Testis-Specific Chr
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
298397.100 100 µg - -

3 - 19 Werktage*

1.151,00 €
 
Chromodomain proteins are components of heterochromatin-like complexes and can act as gene... mehr
Produktinformationen "CDY1, Recombinant, Human, aa2-90, His-Tag (Chromodomain Protein Y-Linked 1, CDY, Testis-Specific Chr"
Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. CDY1 contains a chromodomain and a histone acetyltransferase catalytic domain. CDY1 has histone acetyltransferase activity, with a preference for histone H4. This protein is localized to the nucleus of late spermatids where histone hyperacetylation takes place. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein. Source: Recombinant protein corresponding to aa2-90 from human chromodomain protein Y-linked 1, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~11.7kD, AA Sequence: MHHHHHHASQEFEVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHLM, NCEKCVHDFNRRQTEKQKKLTWTTTSRIFSNNARRRTSRSTKANY, Applications: Suitable for use in protein binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Schlagworte: CDY1, CDY1B, CDY1A, EC=2.3.1.48, Testis-specific chromodomain protein Y 1
Hersteller: United States Biological
Hersteller-Nr: 298397

Eigenschaften

Konjugat: No
MW: 11,7
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -80°C
Versand: -80°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "CDY1, Recombinant, Human, aa2-90, His-Tag (Chromodomain Protein Y-Linked 1, CDY, Testis-Specific Chr"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen