CDK2AP1, Recombinant, Human, aa1-115, GST-Tag (Cyclin-dependent Kinase 2-associated Protein 1)

Specific inhibitor of the cell-cycle kinase CDK2. Source: Recombinant protein corresponding to aa1-115 from human CDK2AP1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.4kD, AA Sequence: MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.