Carboxylesterase 1C, Recombinant, Mouse, aa19-550 (Ces1c)

Carboxylesterase 1C, Recombinant, Mouse, aa19-550 (Ces1c)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405887.20 20 µg - -

3 - 19 Werktage*

570,00 €
405887.100 100 µg - -

3 - 19 Werktage*

832,00 €
 
Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.... mehr
Produktinformationen "Carboxylesterase 1C, Recombinant, Mouse, aa19-550 (Ces1c)"
Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant. Source: Recombinant protein corresponding to aa19-550 from mouse Carboxylesterase 1C, expressed in E. coli. Molecular Weight: ~58.6kD, AA Sequence: HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Es1, Ces1c, PES-N, EC=3.1.1.1, Carboxylesterase 1C, Liver carboxylesterase N, Lung surfactant convertase
Hersteller: United States Biological
Hersteller-Nr: 405887

Eigenschaften

Konjugat: No
MW: 58,6
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Carboxylesterase 1C, Recombinant, Mouse, aa19-550 (Ces1c)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen