Beta-lactamase TEM, Recombinant, E. coli, aa24-286, His-SUMO-Tag (Bla)

Beta-lactamase TEM, Recombinant, E. coli, aa24-286, His-SUMO-Tag (Bla)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
370541.20 20 µg - -

3 - 19 Werktage*

511,00 €
370541.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
T-type are the most prevalent beta-lactamases in enterobacteria, they hydrolyze the beta-lactam... mehr
Produktinformationen "Beta-lactamase TEM, Recombinant, E. coli, aa24-286, His-SUMO-Tag (Bla)"
T-type are the most prevalent beta-lactamases in enterobacteria, they hydrolyze the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. T-3 and T-4 are capable of hydrolyzing cefotaxime and ceftazidime. T-5 is capable of hydrolyzing ceftazidime. T-6 is capable of hydrolyzing ceftazidime and aztreonam. T-8/CAZ-2, T-16/CAZ-7 and T-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors. Source: Recombinant protein corresponding to aa24-286 from Escherichia coli Beta-lactamase TEM, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~44.89kD, AA Sequence: HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: bla, TEM-1, IRT-4, TEM-4, TEM-2, TEM-3, TEM-5, TEM-6, blaT-3, blaT-6, blaT-4, blaT-5, EC=3.5.2.6, TEM-8/CAZ-2, TEM-24/CAZ-6, TEM-16/CAZ-7, Penicillinase, Beta-lactamase TEM
Hersteller: United States Biological
Hersteller-Nr: 370541

Eigenschaften

Konjugat: No
MW: 44,89
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Beta-lactamase TEM, Recombinant, E. coli, aa24-286, His-SUMO-Tag (Bla)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen