ASH1L, Recombinant, Human, aa2433-2548, His-Tag (Ash1 (Absent, Small or Homeotic)-Like, KMT2H, ASH1-

This gene encodes a member of the trithorax group of transcriptional activators. The protein contains four AT hooks, a SET domain, a PHD-finger motif, and a bromodomain. It is localized to many small speckles in the nucleus, and also to cell-cell tight junctions. [provided by RefSeq, Jul 2008], Source: Recombinant protein corresponding to aa2433-2548 from human bromodomain ash1 (absent, small or homeotic)-like, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.2kD, AA Sequence: MHHHHHHEVARAARLAQIFKEICDGIISYKDSSRQALAAPLLNLPPKKKNADYYEKISD, PLDLITIEKQILTGYYKTVEAFDADMLKVFRNAEKYYGRKSPVGRDVCRLRKAYYNAR, HEASAQ, Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.