Aquaporin-4, Recombinant, Mouse, aa253-323, His-Tag (Aqp4)

Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system. Source: Recombinant protein corresponding to aa253-323 from mouse Aquaporin-4, fused to His-Tag at N-terminal, expressed in yeast. Molecular Weight: ~9.9kD, AA Sequence: CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.