Apolipoprotein E, Recombinant, Mouse, aa19-311, His-Tag (ApoE)

Apolipoprotein E, Recombinant, Mouse, aa19-311, His-Tag (ApoE)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
370526.20 20 µg - -

3 - 19 Werktage*

455,00 €
370526.100 100 µg - -

3 - 19 Werktage*

711,00 €
 
Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a... mehr
Produktinformationen "Apolipoprotein E, Recombinant, Mouse, aa19-311, His-Tag (ApoE)"
Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron rnant) of hepatic tissues. Source: Recombinant protein corresponding to aa19-311 from mouse Apoe, fused to His-Tag at N-terminal, expressed in yeast. Molecular Weight: ~35.9kD, AA Sequence: EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Apoe, Apo-E, Apolipoprotein E
Hersteller: United States Biological
Hersteller-Nr: 370526

Eigenschaften

Konjugat: No
MW: 35,9
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Apolipoprotein E, Recombinant, Mouse, aa19-311, His-Tag (ApoE)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen