Annexin A4, Recombinant, Human, aa2-319, His-Sumo-Tag, Myc-Tag (ANXA4)

Annexin A4, Recombinant, Human, aa2-319, His-Sumo-Tag, Myc-Tag (ANXA4)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517802.20 20 µg - -

3 - 19 Werktage*

455,00 €
517802.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in... mehr
Produktinformationen "Annexin A4, Recombinant, Human, aa2-319, His-Sumo-Tag, Myc-Tag (ANXA4)"
Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis. Source: Recombinant protein corresponding to aa2-319 of human Annexin A4, fused to 10xHis-Sumo-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~55.8kD, AA Sequence: ATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: ANX4, P32.5, ANXA4, PP4-X, PAP-II, Annexin-4, Protein II, Annexin A4, Annexin IV, Endonexin I, Lipocortin IV, Chromobindin-4, 35-beta calcimedin, Placental anticoagulant protein II, Carbohydrate-binding protein p33/p41
Hersteller: United States Biological
Hersteller-Nr: 517802

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Human
MW: 55.8 kD
Reinheit: ?85% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Annexin A4, Recombinant, Human, aa2-319, His-Sumo-Tag, Myc-Tag (ANXA4)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen