Annexin A1 (ANXA1) Recombinant, Mouse

Recombinant protein corresponding to aa6-346 with two N-terminal Tags, His-Tag and S-Tag from mouse ANXA1, expressed in E. coli (P10107), Amino Acid Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS-EFLKQ ARFLENQEQE YVQAVKSYKG GPGSAVSPYP SFNVSSDVAA LHKAIMVKGV DEATIIDILT KRTNAQRQQI KAAYLQENGK PLDEVLRKAL TGHLEEVVLA MLKTPAQFDA DELRGAMKGL GTDEDTLIEI LTTRSNEQIR EINRVYREEL KRDLAKDITS DTSGDFRKAL LALAKGDRCQ DLSVNQDLAD TDARALYEAG ERRKGTDVNV FTTILTSRSF PHLRRVFQNY GKYSQHDMNK ALDLELKGDI EKCLTTIVKC ATSTPAFFAE KLYEAMKGAG TRHKALIRIM VSRSEIDMNE IKVFYQKKYG ISLCQAILDE TKGDYEKILV ALCGGN, Predicted Molecular Weight: 43.9kD, Predicted Isoelectric Point: 6.2, Subcellular Location: Nucleus. Cytoplasm Cell projection, cilium. Basolateral cell membrane, Accurate Molecular Mass: 40kD as determined by SDS-PAGE reducing conditions, Note: The possible reasons that the actual band size differs from the predicted are as follows:, 1. Splice variants: Alternative splicing may create different sized proteins from the same gene, 2. Relative charge: The composition of amino acids may affect the charge of the protein., 3. Post-translational modification: Phosphorylation, glycosylation, methylation etc., 4. Post-translation cleavage: Many proteins are synthesized as pro-proteins and then cleaved to give the active form., 5. Polymerization of the target protein: Dimerization, multimerization etc. Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation and SDS-PAGE., Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Included Protein Molecular Weight Marker: 168631: Unstained Protein Molecular Weight Marker, 10-70kD. No heating, diluting or reducing agents needed., MW: 10kD, 14kD, 18kD, 22kD, 26kD, 33kD, 44kD, 70kD , Double intensity: 10kD, 18kD, 26kD, Supplied in 62.5mM Tris-H3PO4, pH 7.5, 1mM EDTA, 2% SDS, 100mM DTT, 1mM sodium azide, 0.01% bromo-phenol blue, 33% glycerol. Add 3-5ul/well for mini gels, 7ul/well for large gels. Store at -20°C Stable for 6 months after receipt. Storage and Stability: Lyophilized powder may be stored at -70°C. Stable for 6 months after receipt. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.