Alpha-synuclein, Recombinant, Rat, aa1-140, GST-Tag (Snca)

Alpha-synuclein, Recombinant, Rat, aa1-140, GST-Tag (Snca)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
370516.50 50 µg - -

3 - 19 Werktage*

431,00 €
370516.100 100 µg - -

3 - 19 Werktage*

629,00 €
 
May be involved in the regulation of dopamine release and transport.||Source:|Recombinant protein... mehr
Produktinformationen "Alpha-synuclein, Recombinant, Rat, aa1-140, GST-Tag (Snca)"
May be involved in the regulation of dopamine release and transport. Source: Recombinant protein corresponding to aa1-140 from rat Snca, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.9kD, AA Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Snca, Alpha-synuclein
Hersteller: United States Biological
Hersteller-Nr: 370516

Eigenschaften

Konjugat: No
MW: 41,9
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Alpha-synuclein, Recombinant, Rat, aa1-140, GST-Tag (Snca)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen