Alkaline Phosphatase, Placental Type, Recombinant, Human, aa117-447, His-Tag (ALPP)

Alkaline Phosphatase, Placental Type, Recombinant, Human, aa117-447, His-Tag (ALPP)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517793.20 20 µg - -

3 - 19 Werktage*

420,00 €
517793.100 100 µg - -

3 - 19 Werktage*

679,00 €
 
In most mammals there are four different isozymes: placental, placental-like, intestinal and... mehr
Produktinformationen "Alkaline Phosphatase, Placental Type, Recombinant, Human, aa117-447, His-Tag (ALPP)"
In most mammals there are four different isozymes: placental, placental-like, intestinal and tissue non-specific (liver/bone/kidney). Source: Recombinant protein corresponding to aa117-447 of human Alkaline Phosphatase, fused to 10xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.9kD, AA Sequence: TATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: ALPP, PLAP, PLAP-1, EC=3.1.3.1, Placental alkaline phosphatase 1, Alkaline phosphatase Regan isozyme, Alkaline phosphatase, placental type
Hersteller: United States Biological
Hersteller-Nr: 517793

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Human
MW: 41.9 kD
Reinheit: ?85% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Alkaline Phosphatase, Placental Type, Recombinant, Human, aa117-447, His-Tag (ALPP)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen