Abrin-A, Recombinant, Abrus Precatorius, aa1-251, His-Tag

Abrin-A, Recombinant, Abrus Precatorius, aa1-251, His-Tag
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517785.20 20 µg - -

3 - 19 Werktage*

511,00 €
517785.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of... mehr
Produktinformationen "Abrin-A, Recombinant, Abrus Precatorius, aa1-251, His-Tag"
The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4,324 of 28S rRNA. Abrin-a is more toxic than ricin. The B chain is a galactose-specific lectin that facilitates the binding of abrin to the cell membrane that precedes endocytosis. Source: Partial recombinant protein corresponding to aa1-251 of Abrus Precatorius Abrin-A, fused to 10xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.6kD, AA Sequence: QDRPIKFSTEGATSQSYKQFIEALRERLRGGLIHDIPVLPDPTTLQERNRYITVELSNSDTESIEVGIDVTNAYVVAYRAGTQSYFLRDAPSSASDYLFTGTDQHSLPFYGTYGDLERWAHQSRQQIPLGLQALTHGISFFRSGGNDNEEKARTLIVIIQMVAEAARFRYISNRVRVSIQTGTAFQPDAAMISLENNWDNLSRGVQESVQDTFPNQVTLTNIRNEPVIVDSLSHPTVAVLALMLFVCNPPN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: EC=3.2.2.22
Hersteller: United States Biological
Hersteller-Nr: 517785

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Abrus Precatorius
MW: 33.6 kD
Reinheit: ?85% (SDS-PAGE)

Datenbank Information

UniProt ID : P11140 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Abrin-A, Recombinant, Abrus Precatorius, aa1-251, His-Tag"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen