14-3-3 Protein Beta/Alpha, Recombinant, Mouse, aa1-246, His-Tag (Ywhab)

14-3-3 Protein Beta/Alpha, Recombinant, Mouse, aa1-246, His-Tag (Ywhab)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517773.20 20 µg - -

3 - 19 Werktage*

497,00 €
517773.100 100 µg - -

3 - 19 Werktage*

827,00 €
 
Adapter protein implicated in the regulation of a large spectrum of both general and specialized... mehr
Produktinformationen "14-3-3 Protein Beta/Alpha, Recombinant, Mouse, aa1-246, His-Tag (Ywhab)"
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis. Blocks the nuclear translocation of the phosphorylated form (by AKT1) of SRPK2 and antagonizes its stimulatory effect on cyclin D1 expression resulting in blockage of neuronal apoptosis elicited by SRPK2. Negative regulator of signaling cascades that mediate activation of MAP kinases via AKAP13. Source: Recombinant full length protein corresponding to aa1-246 of mouse 14-3-3 Protein Beta/Alpha, fused to 10xHis-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~30.6kD, AA Sequence: MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Ywhab
Hersteller: United States Biological
Hersteller-Nr: 517773

Eigenschaften

Konjugat: No
Ursprungsart: Mouse
MW: 30.6 kD
Reinheit: ?85% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "14-3-3 Protein Beta/Alpha, Recombinant, Mouse, aa1-246, His-Tag (Ywhab)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen