Anti-SFTPA1 + SFTPA2

Artikelnummer	Größe	Datenblatt	Manual	SDB	Lieferzeit	Menge	Preis
ARG59549.50	50 µg		-	-	6 - 14 Werktage*		551,00 €

Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage

Protein function: In presence of calcium ions, it binds to surfactant phospholipids and... mehr

Menü schließen

Produktinformationen "Anti-SFTPA1 + SFTPA2"

Protein function: In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages. [The UniProt Consortium]

Schlagworte:	Anti-SP-A, Anti-PSPA, Anti-SP-A1, Anti-PSP-A, Anti-COLEC4, Anti-SFTPA1, Anti-Collectin-4, Anti-Alveolar proteinosis protein, Anti-Pulmonary surfactant-associated protein A1, Anti-35 kDa pulmonary surfactant-associated protein
Hersteller:	Arigo Biolaboratories
Hersteller-Nr:	ARG59549

Eigenschaften

Anwendung:	IHC (frozen), IHC (paraffin)
Antikörper-Typ:	Polyclonal
Konjugat:	No
Wirt:	Rabbit
Spezies-Reaktivität:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to aa. 206-237 of Human SFTPA1/2. (VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN)
MW:	26.2 kD
Format:	Antigen Affinity Purified

Datenbank Information

KEGG ID :	K10067 \| Passende Produkte
UniProt ID :	Q8IWL2 \| Passende Produkte
Gene ID :	GeneID 653509 \| Passende Produkte

Handhabung & Sicherheit

Lagerung:	-20°C
Versand:	+4°C (International: °C)

Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!

Hier folgen Informationen zur Produktreferenz. mehr

Menü schließen

View product citations for antibody ARG59549 on CiteAb

Hier kriegen Sie ein Zertifikat

Zurück

Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.

Bewertungen lesen, schreiben und diskutieren... mehr

Menü schließen

Kundenbewertungen für "Anti-SFTPA1 + SFTPA2"

Bewertung schreiben

Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.