Anti-SCYL3 (SCY1-Like 3 (S. Cerevisiae), PACE-1, PACE1, RP1-97P20.2)

Anti-SCYL3 (SCY1-Like 3 (S. Cerevisiae), PACE-1, PACE1, RP1-97P20.2)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
133052.100 100 µg - -

5 - 10 Werktage*

850,00 €
 
Applications:|Suitable for use in ELISA and Western Blot. Other applications not... mehr
Produktinformationen "Anti-SCYL3 (SCY1-Like 3 (S. Cerevisiae), PACE-1, PACE1, RP1-97P20.2)"
Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: ELISA: 0.1ng/ml, Optimal dilutions to be determined by the researcher. AA Sequence: SLTEESMPWKSSLPQKISLVQRGDDADQIEPPKVSSQERPLKVPSELGLGEEFTIQVKKKPVKDPEMDWFADMIPEIKPSAAFLILPELRTEMVPKKDDVSPVMQFSS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 133052

Eigenschaften

Anwendung: ELISA, WB
Antikörper-Typ: Monoclonal
Klon: 3D3
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Partial recombinant corresponding to aa553-661 from human SCYL3 (NP_065156) with GST tag. MW of the GST tag alone is 26kD.
Reinheit: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SCYL3 (SCY1-Like 3 (S. Cerevisiae), PACE-1, PACE1, RP1-97P20.2)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen