Zu "K17542" wurden 24 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-SCYL3
Artikelnummer: ATA-HPA005624.100
Protein function: May play a role in regulating cell adhesion/migration complexes in migrating cells. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 53% and to rat: 53%
| Schlagworte: | Anti-PACE1, Anti-SCYL3, Anti-SCY1-like protein 3, Anti-Ezrin-binding protein PACE-1, Anti-Protein-associating with the... |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Anti-SCYL3
Artikelnummer: ABS-KC-3762.100
Protein function: May play a role in regulating cell adhesion/migration complexes in migrating cells. [The UniProt Consortium]
| Schlagworte: | Anti-Protein-associating with the carboxyl-terminal domain of ezrin, Anti-Ezrin-binding protein PACE-1, Anti-SCY1-like... |
| Anwendung: | IHC |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €
Anti-SCYL3
Artikelnummer: ATA-HPA072383.100
Polyclonal Antibody against Human SCYL3, Gene description: SCY1 like pseudokinase 3, Alternative Gene Names: PACE-1, PACE1, Validated applications: ICC, WB, Uniprot ID: Q8IZE3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May play a role in regulating...
| Schlagworte: | Anti-PACE1, Anti-SCYL3, Anti-SCY1-like protein 3, Anti-Ezrin-binding protein PACE-1, Anti-Protein-associating with the... |
| Anwendung: | WB, ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Anti-Human SCYL3 Antibody Pair
Artikelnummer: ABS-ES-2106.1
Product Description: SCY1 like pseudokinase 3 (SCYL3), also known as PACE-1, is a member of the SCYL protein family characterized by an inactive kinase domain, central HEAT repeats, and a disorganized C-terminal segment. Unlike conventional kinases, SCYL3's pseudokinase domain lacks catalytic activity but may play...
| Schlagworte: | Anti-SCYL3, Anti-SCY1-like protein 3, Anti-Ezrin-binding protein PACE-1, Anti-Protein-associating with the... |
| Anwendung: | ELISA |
| Wirt: | Mouse/Mouse |
| Spezies-Reaktivität: | human |
1.080,00 €
Anti-Human SCYL3 Antibody Pair
Artikelnummer: ABS-ES-2107.1
Product Description: SCY1 like pseudokinase 3 (SCYL3), also known as PACE-1, is a member of the SCYL protein family characterized by an inactive kinase domain, central HEAT repeats, and a disorganized C-terminal segment. Unlike conventional kinases, SCYL3's pseudokinase domain lacks catalytic activity but may play...
| Schlagworte: | Anti-SCYL3, Anti-SCY1-like protein 3, Anti-Ezrin-binding protein PACE-1, Anti-Protein-associating with the... |
| Anwendung: | ELISA |
| Wirt: | Mouse/Mouse |
| Spezies-Reaktivität: | human |
1.080,00 €
Anti-Human SCYL3 Antibody Pair
Artikelnummer: ABS-ES-2108.1
Product Description: SCY1 like pseudokinase 3 (SCYL3), also known as PACE-1, is a member of the SCYL protein family characterized by an inactive kinase domain, central HEAT repeats, and a disorganized C-terminal segment. Unlike conventional kinases, SCYL3's pseudokinase domain lacks catalytic activity but may play...
| Schlagworte: | Anti-SCYL3, Anti-SCY1-like protein 3, Anti-Ezrin-binding protein PACE-1, Anti-Protein-associating with the... |
| Anwendung: | ELISA |
| Wirt: | Mouse/Mouse |
| Spezies-Reaktivität: | human |
1.080,00 €
Anti-SCYL3
Artikelnummer: ATA-HPA072383.25
Polyclonal Antibody against Human SCYL3, Gene description: SCY1 like pseudokinase 3, Alternative Gene Names: PACE-1, PACE1, Validated applications: ICC, WB, Uniprot ID: Q8IZE3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May play a role in regulating...
| Schlagworte: | Anti-PACE1, Anti-SCYL3, Anti-SCY1-like protein 3, Anti-Ezrin-binding protein PACE-1, Anti-Protein-associating with the... |
| Anwendung: | WB, ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
SCYL3 protein-GST fusion
Artikelnummer: 009-001-T27S
Recombinant human SCYL3 (2-end) was expressed by baculovirus in Sf9 insect cells using an N-Terminal Glutathione-S-Transferase fusion protein. The purity was determined to be >85% by densitometry. Protein function: May play a role in regulating cell adhesion/migration complexes in migrating cells. [The UniProt...
| Schlagworte: | PACE1, SCYL3, SCY1-like protein 3, Ezrin-binding protein PACE-1, Protein-associating with the carboxyl-terminal domain of... |
| Anwendung: | WB |
| Exprimiert in: | Human |
497,00 €
Anti-Scyl3, CT (Scyl3, Pace1, Protein-associating with...
Artikelnummer: 041482.200
Scyl3 may play a role in regulating cell adhesion/migration complexes in migrating cells. Applications: Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Immunohistochemistry: 1:10-50, Storage and Stability: May be stored at 4°C for...
| Schlagworte: | Anti-Scyl3, Anti-Pace1, Anti-SCY1-like protein 3, Anti-Ezrin-binding protein PACE-1, Anti-Protein-associating with the... |
| Anwendung: | ELISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse |
865,00 €
Anti-SCYL3 (SCY1-Like 3 (S. Cerevisiae), PACE-1, PACE1,...
Artikelnummer: 133050.50
Applications:, Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence:...
| Anwendung: | IF, WB |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
850,00 €
Anti-SCYL3 (SCY1-Like 3 (S. Cerevisiae), PACE-1, PACE1,...
Artikelnummer: 133051.100
Applications:, Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence:...
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
943,00 €
Anti-SCYL3 (SCY1-Like 3 (S. Cerevisiae), PACE-1, PACE1,...
Artikelnummer: 133052.100
Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: ELISA: 0.1ng/ml, Optimal dilutions to be determined by the researcher. AA Sequence: SLTEESMPWKSSLPQKISLVQRGDDADQIEPPKVSSQERPLKVPSELGLGEEFTIQVKKKPVKDPEMDWFADMIPEIKPSAAFLILPELRTEMVPKKDDVSPVMQFSS, Storage and...
| Anwendung: | ELISA, WB |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
850,00 €