Zu "Q8IZE3" wurden 24 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-SCYL3
Anti-SCYL3

Artikelnummer: ATA-HPA005624.100

Protein function: May play a role in regulating cell adhesion/migration complexes in migrating cells. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 53% and to rat: 53%
Schlagworte: Anti-PACE1, Anti-SCYL3, Anti-SCY1-like protein 3, Anti-Ezrin-binding protein PACE-1, Anti-Protein-associating with the...
Anwendung: IHC, WB
Wirt: Rabbit
Spezies-Reaktivität: human
ab 246,00 €
Bewerten
Anti-SCYL3
Anti-SCYL3

Artikelnummer: ABS-KC-3762.100

Protein function: May play a role in regulating cell adhesion/migration complexes in migrating cells. [The UniProt Consortium]
Schlagworte: Anti-Protein-associating with the carboxyl-terminal domain of ezrin, Anti-Ezrin-binding protein PACE-1, Anti-SCY1-like...
Anwendung: IHC
Wirt: Mouse
Spezies-Reaktivität: human
ab 206,00 €
Bewerten
Anti-SCYL3
Anti-SCYL3

Artikelnummer: ATA-HPA072383.100

Polyclonal Antibody against Human SCYL3, Gene description: SCY1 like pseudokinase 3, Alternative Gene Names: PACE-1, PACE1, Validated applications: ICC, WB, Uniprot ID: Q8IZE3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May play a role in regulating...
Schlagworte: Anti-PACE1, Anti-SCYL3, Anti-SCY1-like protein 3, Anti-Ezrin-binding protein PACE-1, Anti-Protein-associating with the...
Anwendung: WB, ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
Anti-Human SCYL3 Antibody Pair
Anti-Human SCYL3 Antibody Pair

Artikelnummer: ABS-ES-2106.1

Product Description: SCY1 like pseudokinase 3 (SCYL3), also known as PACE-1, is a member of the SCYL protein family characterized by an inactive kinase domain, central HEAT repeats, and a disorganized C-terminal segment. Unlike conventional kinases, SCYL3's pseudokinase domain lacks catalytic activity but may play...
Schlagworte: Anti-SCYL3, Anti-SCY1-like protein 3, Anti-Ezrin-binding protein PACE-1, Anti-Protein-associating with the...
Anwendung: ELISA
Wirt: Mouse/Mouse
Spezies-Reaktivität: human
1.080,00 €
Bewerten
Anti-Human SCYL3 Antibody Pair
Anti-Human SCYL3 Antibody Pair

Artikelnummer: ABS-ES-2107.1

Product Description: SCY1 like pseudokinase 3 (SCYL3), also known as PACE-1, is a member of the SCYL protein family characterized by an inactive kinase domain, central HEAT repeats, and a disorganized C-terminal segment. Unlike conventional kinases, SCYL3's pseudokinase domain lacks catalytic activity but may play...
Schlagworte: Anti-SCYL3, Anti-SCY1-like protein 3, Anti-Ezrin-binding protein PACE-1, Anti-Protein-associating with the...
Anwendung: ELISA
Wirt: Mouse/Mouse
Spezies-Reaktivität: human
1.080,00 €
Bewerten
Anti-Human SCYL3 Antibody Pair
Anti-Human SCYL3 Antibody Pair

Artikelnummer: ABS-ES-2108.1

Product Description: SCY1 like pseudokinase 3 (SCYL3), also known as PACE-1, is a member of the SCYL protein family characterized by an inactive kinase domain, central HEAT repeats, and a disorganized C-terminal segment. Unlike conventional kinases, SCYL3's pseudokinase domain lacks catalytic activity but may play...
Schlagworte: Anti-SCYL3, Anti-SCY1-like protein 3, Anti-Ezrin-binding protein PACE-1, Anti-Protein-associating with the...
Anwendung: ELISA
Wirt: Mouse/Mouse
Spezies-Reaktivität: human
1.080,00 €
Bewerten
Anti-SCYL3
Anti-SCYL3

Artikelnummer: ATA-HPA072383.25

Polyclonal Antibody against Human SCYL3, Gene description: SCY1 like pseudokinase 3, Alternative Gene Names: PACE-1, PACE1, Validated applications: ICC, WB, Uniprot ID: Q8IZE3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May play a role in regulating...
Schlagworte: Anti-PACE1, Anti-SCYL3, Anti-SCY1-like protein 3, Anti-Ezrin-binding protein PACE-1, Anti-Protein-associating with the...
Anwendung: WB, ICC
Wirt: Rabbit
Spezies-Reaktivität: human
361,00 €
Bewerten
SCYL3 protein-GST fusion
SCYL3 protein-GST fusion

Artikelnummer: 009-001-T27S

Recombinant human SCYL3 (2-end) was expressed by baculovirus in Sf9 insect cells using an N-Terminal Glutathione-S-Transferase fusion protein. The purity was determined to be >85% by densitometry. Protein function: May play a role in regulating cell adhesion/migration complexes in migrating cells. [The UniProt...
Schlagworte: PACE1, SCYL3, SCY1-like protein 3, Ezrin-binding protein PACE-1, Protein-associating with the carboxyl-terminal domain of...
Anwendung: WB
Exprimiert in: Human
497,00 €
Bewerten
PACE-1, Human, Real Time PCR Primer Set
PACE-1, Human, Real Time PCR Primer Set

Artikelnummer: VHPS-6591

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: PACE1, SCYL3, SCY1-like protein 3, Ezrin-binding protein PACE-1, Protein-associating with the carboxyl-terminal domain of...
Anwendung: RNA quantification
45,00 €
Bewerten
Anti-SCYL3 (SCY1-Like 3 (S. Cerevisiae), PACE-1, PACE1, RP1-97P20.2)
Anti-SCYL3 (SCY1-Like 3 (S. Cerevisiae), PACE-1, PACE1,...

Artikelnummer: 133050.50

Applications:, Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence:...
Anwendung: IF, WB
Wirt: Mouse
Spezies-Reaktivität: human
850,00 €
Bewerten
Anti-SCYL3 (SCY1-Like 3 (S. Cerevisiae), PACE-1, PACE1, RP1-97P20.2)
Anti-SCYL3 (SCY1-Like 3 (S. Cerevisiae), PACE-1, PACE1,...

Artikelnummer: 133051.100

Applications:, Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence:...
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human
943,00 €
Bewerten
Anti-SCYL3 (SCY1-Like 3 (S. Cerevisiae), PACE-1, PACE1, RP1-97P20.2)
Anti-SCYL3 (SCY1-Like 3 (S. Cerevisiae), PACE-1, PACE1,...

Artikelnummer: 133052.100

Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: ELISA: 0.1ng/ml, Optimal dilutions to be determined by the researcher. AA Sequence: SLTEESMPWKSSLPQKISLVQRGDDADQIEPPKVSSQERPLKVPSELGLGEEFTIQVKKKPVKDPEMDWFADMIPEIKPSAAFLILPELRTEMVPKKDDVSPVMQFSS, Storage and...
Anwendung: ELISA, WB
Wirt: Mouse
Spezies-Reaktivität: human
850,00 €
Bewerten
1 von 2 Seiten