Anti-Regucalcin

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59204.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Gluconolactonase with low activity towards other sugar lactones, including... mehr
Produktinformationen "Anti-Regucalcin"
Protein function: Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca(2+) signaling, and Ca(2+)-dependent cellular processes and enzyme activities. [The UniProt Consortium]
Schlagworte: Anti-RC, Anti-RGN, Anti-GNL, Anti-SMP30, Anti-SMP-30, Anti-Regucalcin, EC=3.1.1.17, Anti-Gluconolactonase, Anti-Senescence marker protein 30
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59204

Eigenschaften

Anwendung: IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Human Regucalcin. (YSVDAFDYDLQTGQISNRRSVYKLEKEEQIPD)
MW: 33 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Regucalcin"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen