Anti-Regucalcin

Anti-Regucalcin
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4348 100 µg - -

3 - 10 Werktage*

772,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Regucalcin is a protein that in humans is... mehr
Produktinformationen "Anti-Regucalcin"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Regucalcin is a protein that in humans is encoded by the RGN gene. The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23. Protein function: Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca(2+) signaling, and Ca(2+)-dependent cellular processes and enzyme activities. [The UniProt Consortium]
Schlagworte: Anti-RC, Anti-GNL, Anti-RGN, Anti-SMP30, Anti-SMP-30, Anti-Regucalcin, EC=3.1.1.17, Anti-Gluconolactonase, Anti-Senescence marker protein 30, Regucalcin Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4348

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids YSVDAFDYDLQTGQISNRRSVYKLEKEEQIPD were used as the immunogen for the Regucalcin antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Regucalcin"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen