Anti-MAOA

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40378.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has... mehr
Produktinformationen "Anti-MAOA"
Protein function: Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine. [The UniProt Consortium]
Schlagworte: Anti-MAOA, Anti-MAO-A, EC=1.4.3.4, Anti-Monoamine oxidase type A, Anti-Amine oxidase [flavin-containing] A
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40378

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 457-493 of Human MAOA. (REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER)
MW: 59 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-MAOA"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen