Anti-Granzyme B (C11, CTLA-1, Cathepsin G-like 1, CTSGL1, Cytotoxic T-lymphocyte Proteinase 2, Lymph

Anti-Granzyme B (C11, CTLA-1, Cathepsin G-like 1, CTSGL1, Cytotoxic T-lymphocyte Proteinase 2, Lymph
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
127521.100 100 µg - -

3 - 19 Werktage*

715,00 €
 
Granzyme A and granzyme B are serine proteases that mediate apoptotic signaling in cytotoxic T... mehr
Produktinformationen "Anti-Granzyme B (C11, CTLA-1, Cathepsin G-like 1, CTSGL1, Cytotoxic T-lymphocyte Proteinase 2, Lymph"
Granzyme A and granzyme B are serine proteases that mediate apoptotic signaling in cytotoxic T lymphocytes (CTL) and in natural killer (NK) cells. Both granzyme A and granzyme B are synthesized as inactive proenzymes that are stored within cytolytic granules and released by effector cells during degradation. Granzyme B should be useful for localization of granzyme B-containing lytic granules and characterization of activated CTLs or NK cells. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 127521

Eigenschaften

Anwendung: ELISA, IP, WB
Antikörper-Typ: Monoclonal
Klon: 4F5
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Partial recombinant corresponding to aa148-247 from human GZMB (AAH30195) with GST tag. MW of the GST tag alone is 26kD.
Reinheit: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Granzyme B (C11, CTLA-1, Cathepsin G-like 1, CTSGL1, Cytotoxic T-lymphocyte Proteinase 2, Lymph"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen