Anti-CREBBP (CREB-binding Protein, CBP)

CREB Binding Protein plays an important part in regulating cell growth and division through binding to the KID domain of the transcription factor CREB (short for cAMP response element binding). Abnormalities in the CBP gene leading to a reduction in protein levels can affect normal development causing some of the symptoms associated with Rubinstein-Taybi syndrome. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: PVHAQPPGTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.