Anti-Caspase-2

Anti-Caspase-2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32097 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CASP2 is equal to Caspase-2. And... mehr
Produktinformationen "Anti-Caspase-2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CASP2 is equal to Caspase-2. And Caspase-2, which is involved in stress-induced apoptosis, is recruited into a large protein complex, the molecular composition of which remains elusive. It is showed that activation of caspase-2 occurs in a complex that contains the death domain-containing protein PIDD, whose expression is induced by p53, and the adaptor protein RAIDD. Increased PIDD expression resulted in spontaneous activation of caspase-2 and sensitization to apoptosis by genotoxic stimuli. Caspase-2 acts both as a positive and negative cell death effector, depending upon cell lineage and stage of development. Protein function: Involved in the activation cascade of caspases responsible for apoptosis execution. Might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival. [The UniProt Consortium]
Schlagworte: Anti-ICH1, Anti-CASP2, EC=3.4.22.55, Caspase-2 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32097

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids RNTKRGSWYIEALAQVFSERACDMHVADMLVK of human Caspase-2 were used as the immunogen for the Caspase-2 antibody. This sequence is found on the small subunit.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Caspase-2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen