Anti-ACTN3 / Alpha Actinin 3, clone 9B5

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4625 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Alpha-actinin-3, also known as... mehr
Produktinformationen "Anti-ACTN3 / Alpha Actinin 3, clone 9B5"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants, the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status. Protein function: F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein. [The UniProt Consortium]
Schlagworte: Anti-ACTN3, Anti-Alpha-actinin-3, Anti-F-actin cross-linking protein, Anti-Alpha-actinin skeletal muscle isoform 3, ACTN3 Antibody / Alpha Actinin 3
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4625

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Monoclonal
Klon: 9B5
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: mouse, rat
Immunogen: Amino acids EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ACTN3 / Alpha Actinin 3, clone 9B5"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen