Anti-alpha Actinin 3

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40278.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: F-actin cross-linking protein which is thought to anchor actin to a variety of... mehr
Produktinformationen "Anti-alpha Actinin 3"
Protein function: F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein. [The UniProt Consortium]
Schlagworte: Anti-ACTN3, Anti-Alpha-actinin-3, Anti-F-actin cross-linking protein, Anti-Alpha-actinin skeletal muscle isoform 3
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40278

Eigenschaften

Anwendung: FC, IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 574-617 of Human alpha Actinin 3. (EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK)
MW: 103 kD
Format: Antigen Affinity Purified

Datenbank Information

KEGG ID : K21073 | Passende Produkte
UniProt ID : Q08043 | Passende Produkte
Gene ID : GeneID 89 | Passende Produkte

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-alpha Actinin 3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen