Anti-Wnt7b

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41698.50 50 µl - -

6 - 14 Werktage*

584,00 €
 
Protein function: Ligand for members of the frizzled family of seven transmembrane receptors that... mehr
Produktinformationen "Anti-Wnt7b"
Protein function: Ligand for members of the frizzled family of seven transmembrane receptors that functions in the canonical Wnt/beta- catenin signaling pathway (PubMed:30026314). Required for normal fusion of the chorion and the allantois during placenta development. Required for central nervous system (CNS) angiogenesis and blood-brain barrier regulation (PubMed:30026314). [The UniProt Consortium]
Schlagworte: Anti-WNT7B, Anti-Protein Wnt-7b
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41698

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse (Erwartet: cow, rat, dog, guinea pig, horse, swine)
Immunogen: Synthetic peptide around the middle region of Human Wnt7b. (within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM)
MW: 39 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Wnt7b"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen