Anti-Wnt7a

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41733.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Ligand for members of the frizzled family of seven transmembrane receptors that... mehr
Produktinformationen "Anti-Wnt7a"
Protein function: Ligand for members of the frizzled family of seven transmembrane receptors that functions in the canonical Wnt/beta- catenin signaling pathway. Plays an important role in embryonic development, including dorsal versus ventral patterning during limb development, skeleton development and urogenital tract development (PubMed:16826533). Required for central nervous system (CNS) angiogenesis and blood-brain barrier regulation (PubMed:30026314). Required for normal, sexually dimorphic development of the Mullerian ducts, and for normal fertility in both sexes. Required for normal neural stem cell proliferation in the hippocampus dentate gyrus. Required for normal progress through the cell cycle in neural progenitor cells, for self-renewal of neural stem cells, and for normal neuronal differentiation and maturation. Promotes formation of synapses via its interaction with FZD5. [The UniProt Consortium]
Schlagworte: Anti-WNT7A, Anti-Protein Wnt-7a
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41733

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat (Erwartet: bovine)
Immunogen: Synthetic peptide corresponding to aa. 226-256 of Human Wnt7a. (YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK)
MW: 39 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Wnt7a"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen