Anti-UBA3

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59226.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Catalytic subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by... mehr
Produktinformationen "Anti-UBA3"
Protein function: Catalytic subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M. Down-regulates steroid receptor activity. Necessary for cell cycle progression. [The UniProt Consortium]
Schlagworte: Anti-UBA3, Anti-UBE1C, EC=6.2.1.-, Anti-NEDD8-activating enzyme E1C, Anti-Ubiquitin-activating enzyme 3, Anti-Ubiquitin-activating enzyme E1C, Anti-Ubiquitin-like modifier-activating enzyme 3, Anti-NEDD8-activating enzyme E1 catalytic subunit
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59226

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat (Erwartet: bovine, dog, horse, monkey, rabbit)
Immunogen: Synthetic peptide corresponding to aa. 409-448 of Human UBA3. (KNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVAD)
MW: 52 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-UBA3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen