Anti-TRPM3

Anti-TRPM3
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40779.50 50 µl - -

6 - 14 Werktage*

551,00 €
 
Protein function: Calcium channel mediating constitutive calcium ion entry. Its activity is... mehr
Produktinformationen "Anti-TRPM3"
Protein function: Calcium channel mediating constitutive calcium ion entry. Its activity is increased by reduction in extracellular osmolarity, by store depletion and muscarinic receptor activation. [The UniProt Consortium]
Schlagworte: Anti-TRPM3, Anti-MLSN2, Anti-LTrpC3, Anti-LTrpC-3, Anti-KIAA1616, Anti-Melastatin-2, Anti-Long transient receptor potential channel 3, Anti-Transient receptor potential cation channel subfamily M member 3
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40779

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, rat, cow, dog, guinea pig, horse, rabbit, zebrafish)
Immunogen: Synthetic peptide around the N-terminal region of Human TRPM3. (Within the following region: ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD)
MW: 188 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-TRPM3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen