Anti-SP1, clone 1A5

Anti-SP1, clone 1A5
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG55542.50 50 µg - -

6 - 14 Werktage*

740,00 €
 
Protein function: Transcription factor that can activate or repress transcription in response to... mehr
Produktinformationen "Anti-SP1, clone 1A5"
Protein function: Transcription factor that can activate or repress transcription in response to physiological and pathological stimuli. Binds with high affinity to GC-rich motifs and regulates the expression of a large number of genes involved in a variety of processes such as cell growth, apoptosis, differentiation and immune responses. Highly regulated by post-translational modifications (phosphorylations, sumoylation, proteolytic cleavage, glycosylation and acetylation). Binds also the PDGFR- alpha G-box promoter. May have a role in modulating the cellular response to DNA damage. Implicated in chromatin remodeling. Plays a role in the recruitment of SMARCA4/BRG1 on the c-FOS promoter. Plays an essential role in the regulation of FE65 gene expression. In complex with ATF7IP, maintains telomerase activity in cancer cells by inducing TERT and TERC gene expression. Isoform 3 is a stronger activator of transcription than isoform 1. Positively regulates the transcription of the core clock component ARNTL/BMAL1. [The UniProt Consortium]
Schlagworte: Anti-SP1, Anti-TSFP1, Anti-Transcription factor Sp1
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG55542

Eigenschaften

Anwendung: ICC, IF, IHC (paraffin)
Antikörper-Typ: Monoclonal
Klon: 1A5
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human, mouse
Immunogen: Synthetic peptide around aa. 89-199 of Human SP1 (with GST tag).GTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQ*
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SP1, clone 1A5"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen