Anti-SOD2 (Superoxide Dismutase [Mn], Mitochondrial)

Anti-SOD2 (Superoxide Dismutase [Mn], Mitochondrial)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
133696.100 100 µg - -

3 - 19 Werktage*

761,00 €
 
SOD2 is a member of the iron/manganese superoxide dismutase family. It is a mitochondrial matrix... mehr
Produktinformationen "Anti-SOD2 (Superoxide Dismutase [Mn], Mitochondrial)"
SOD2 is a member of the iron/manganese superoxide dismutase family. It is a mitochondrial matrix protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this protein have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Recombinant human SOD2 protein was expressed in E. coli. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 133696

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Full length human SOD2, aa1-222 (AAH12423.1).
Reinheit: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SOD2 (Superoxide Dismutase [Mn], Mitochondrial)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen